PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000179145
Common NameWRKY10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 528aa    MW: 57629.7 Da    PI: 8.4203
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000179145genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1054.1e-33242298259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    dD ynWrKYGqK+vkgsefprsYY+Ct+ +Cpvkkkvers  +++++ei+Y+g+Hnhe
  MDP0000179145 242 DDXYNWRKYGQKQVKGSEFPRSYYKCTHMNCPVKKKVERSP-NGEITEIIYKGQHNHE 298
                    8****************************************.***************8 PP

2WRKY1023.5e-32414472159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++pr YY+Ct+agC+v+k+ver+++d k+v++tYeg+Hnh+
  MDP0000179145 414 LDDGYRWRKYGQKVVKGNPHPRCYYKCTFAGCNVRKHVERASTDAKAVITTYEGKHNHD 472
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-28231300IPR003657WRKY domain
PROSITE profilePS5081123.812236300IPR003657WRKY domain
SuperFamilySSF1182908.63E-26238300IPR003657WRKY domain
SMARTSM007743.0E-36241299IPR003657WRKY domain
PfamPF031063.2E-25242298IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.5E-36399474IPR003657WRKY domain
SuperFamilySSF1182901.18E-28406474IPR003657WRKY domain
PROSITE profilePS5081137.665409474IPR003657WRKY domain
SMARTSM007742.5E-38414473IPR003657WRKY domain
PfamPF031065.8E-25415472IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MAAKTQDSDR VTVSAPPLLP TQRPVITLPP RPSAEAFFSG GSGASPGPMT LVSNFFDTYP  60
ESDFRSFSQL LAGAMGSPVG STRGMSXFTE NPADGLRKXG GGSESGEGSS GFKQSRPMSL  120
AVARPPLFTV PPGLSPSGLL NSPGFYSPQS PFGMSHQQAL AQVTAQAALA QSRVYMQPEY  180
QPSSVAPPTE PEERQLSLMP NEASQQQTLP STSNTKSSAR QSPEASHSDK KYQPSSTDRP  240
ADDXYNWRKY GQKQVKGSEF PRSYYKCTHM NCPVKKKVER SPNGEITEII YKGQHNHEVP  300
QPSKRPKDGD LNGPKPENGL QRRIGDSNRS SENVASYSRX EMDQESTQAA PGQLPGENDN  360
EELGDGESRE EGDADEPNAK RRNIDVGASE VALPHKTVTE PKIIVQTRSE VDLLDDGYRW  420
RKYGQKVVKG NPHPRCYYKC TFAGCNVRKH VERASTDAKA VITTYEGKHN HDVPAARNSS  480
HNTANNSASQ LKPPASGASQ HTLLKGREYG NNDQRPVLLQ LKEEQIFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-38242475878Probable WRKY transcription factor 4
2lex_A5e-38242475878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.126970.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP0529390.0KP052939.1 Pyrus pyrifolia WRKY transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348080.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ701e-151WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLD9ZJE90.0D9ZJE9_MALDO; WRKY domain class transcription factor
STRINGGLYMA18G49830.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-119WRKY DNA-binding protein 3